SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347524387|ref|YP_004781957.1| from Pyrolobus fumarii 1A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347524387|ref|YP_004781957.1|
Domain Number 1 Region: 117-357
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.24e-61
Family D-glucarate dehydratase-like 0.0000399
Further Details:      
 
Domain Number 2 Region: 7-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.5e-21
Family Enolase N-terminal domain-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347524387|ref|YP_004781957.1|
Sequence length 360
Comment Mandelate racemase/muconate lactonizing protein [Pyrolobus fumarii 1A]
Sequence
MQALPRVSSVEVFTLEVRVRGVFRIALGAETRVETLYVKVTLDDGSVGWGEGAPAPRITG
EYPRAALEAARIASQHLPGIRLPEELSDALELLSRLLPRSPAARAALESALLDAYSRSIG
APLCALLGGCRSEPLRTSFTISLDEPEVMASKAAEAVEKGFRRLKLKLGGPPSLDIARVE
AVRKAVGDDAEIMVDANQAWSLAAANKVIPRLESLGVMLVEQPLPAWDLRGLAELSRRSP
IPIAVDESVMDMHDLAELVGLGFRGVVNVKVSRVGGPLRAARILQASVDMGLEAMVGCML
ETSLGISHAVHAVSTVKPSFVDLDAPLLLERDPAACKVYDGVMVAPPRGPGVGCEPRLSV
Download sequence
Identical sequences G0ECY5
WP_014027382.1.63292 gi|347524387|ref|YP_004781957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]