SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386845012|ref|YP_006258971.1| from Rahnella aquatilis HX2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386845012|ref|YP_006258971.1|
Domain Number 1 Region: 198-443
Classification Level Classification E-value
Superfamily Colicin 7.19e-68
Family Colicin 0.000000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386845012|ref|YP_006258971.1|
Sequence length 444
Comment hypothetical protein Q7S_25741 [Rahnella aquatilis HX2]
Sequence
MSGFNYGGYGDGTGWSSESGGGTTPGGSTGNSGNNDNGGNGTTNPQQQQISAIRRDPAVI
KKLSSLITAARKINPYAKVTIQSISKSGVLNISVTELDVTQAGQIGLSGLVMGVDVNGTK
LAIGNLATGHARTSDNKKYVNNPVPTSGEVFSSGGTISWSFDPKTGAYLSPKPFADGITI
KSITITGPYTYKLVFDFTPDSYVIVTVNNGNPNTISTKFYNWKGPESGFPKVAVTAVKDF
IQSKLAEERDLLIQTSDAIIAVGQETSKTLGEKYKSVANEIAADIRNFQGKTIRTHADAM
AALNRVLQNPGMKINASDKDAIVNAWNHLNATDMAYKLGFLGKIFTAADVVIKIDKVREK
SIEGYQTGNWSPLMLEVESWVLSGMASGIALGILAYVAPVVATTFGLPVTAVTILGIIGI
TLAASLIDDKLADKINNEVIRPVH
Download sequence
Identical sequences H8P115
WP_014683010.1.91760 gi|386845012|ref|YP_006258971.1|NC_017773 gi|386845012|ref|YP_006258971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]