SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384259993|ref|YP_005403927.1| from Rahnella aquatilis HX2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384259993|ref|YP_005403927.1|
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-44
Family Phosphate binding protein-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384259993|ref|YP_005403927.1|
Sequence length 259
Comment arogenate dehydratase [Rahnella aquatilis HX2]
Sequence
MKKVFYSLVLLSVLPGLAKAEPASSRLERVLQKGSLNVCTTGDYKPYTFLKENGEYEGID
IAMAESLAASLDVKVNWVPVTWKSLPDEMSAGHCDIAMGGISVTLKRQQKAWFANVLDQD
GKIPLVRCENVRQYQTVEQLNRASVRLIEPAGGTNEAFVHSHLPKGTLTLSDNVTIFQKL
VDKKADVMITDASEALFQQKHYPKLCAVNPKKPLQYGEKAYMLPRDDVSWKMYVDQWLHL
SKATGEYQKIVSQWLAVKK
Download sequence
Identical sequences A0A0H3FF74 H8NQN5
gi|384259993|ref|YP_005403927.1| gi|322834773|ref|YP_004214800.1| WP_013577361.1.59798 WP_013577361.1.91760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]