SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55378268|ref|YP_136118.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55378268|ref|YP_136118.1|
Domain Number 1 Region: 173-323
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.75e-33
Family Mevalonate 5-diphosphate decarboxylase 0.035
Further Details:      
 
Domain Number 2 Region: 1-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.68e-33
Family GHMP Kinase, N-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55378268|ref|YP_136118.1|
Sequence length 324
Comment diphosphomevalonate decarboxylase [Haloarcula marismortui ATCC 43049]
Sequence
MKATAKAHPIQGLVKYHGMRDEELRLPYHDSISVCTAPSHSKTTAAFDPNREVDVYVIDG
ETVTGRGAERIDAVVDHVRDLAGIDHGVRFESANNFPTNIGFGSSSSGFAAAAMALVEAA
GLDMTRPEISTVARRGSSSAARAVTGAFSHLRTGMNDRDCRSERIETDLEDDLRIVAGMV
PSYKETEEAHKEAAESHMFESRMAHIHSQISDMRDALYDGDFDAVFDLAEKDSLSLAAAT
MTGPAGWVYWQPRTIEIFNAVRELRNTEDVPVYFSVDTGASVYINTTEEYVGRVEETVAD
CGVDTRVWDVGGPAQILDEDKALF
Download sequence
Identical sequences Q5V240
WP_011223657.1.69175 272569.rrnAC1489 gi|55378268|ref|YP_136118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]