SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55379895|ref|YP_137745.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55379895|ref|YP_137745.1|
Domain Number 1 Region: 30-177
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-31
Family GHMP Kinase, N-terminal domain 0.0000394
Further Details:      
 
Domain Number 2 Region: 184-319
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.01e-28
Family Homoserine kinase 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55379895|ref|YP_137745.1|
Sequence length 320
Comment homoserine kinase [Haloarcula marismortui ATCC 43049]
Sequence
MPLGRVLSTGKRPQCRFATFLPTLLKFAGMLTVRAPATSANLGSGFDVFGVALERPADVV
RLEKADRVTIDVTGAGSQYIPEDPDKNTVGAVADALDAPARIQIDKGVRPASGLGSSAAS
AAAAAVGLNELYDRGYSREELVPIAAKGEAVVSGDAHDDNVAPSIMGGFTIATDKGVTQV
DADIPLVACLPDIVVSTRDARNVVPETARVDQMVETVGNAASLTTGMHRDDPELVGQGMH
DTVVTPARAKLIDGYEQVREAALAAGATGVTISGAGPTVIAACAEEDRRQIASTMLDAFG
ERGVDARVYQTRIGGGAEVF
Download sequence
Identical sequences 272569.rrnAC3348 gi|55379895|ref|YP_137745.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]