SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55380347|ref|YP_138196.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55380347|ref|YP_138196.1|
Domain Number 1 Region: 2-276
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.02e-46
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 270-442
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.57e-32
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55380347|ref|YP_138196.1|
Sequence length 454
Comment 2', 3'-cyclic nucleotide 2'-phosphodiesterase [Haloarcula marismortui ATCC 43049]
Sequence
MSVRLLHYSDIENACDDPVRMGRLAGTIQSIRGEDAVVAGTGDNTAPGVLAHYCEGRQVI
PFFRAVSTDIGTVGNHDFDFGTAPILDVVSESPQKWIVANVFEGEREGGRGVPFAGLDGT
TVLHRDDQRVGFVGVIDPATPRIAPTGASELTVTSPVESVQTAVSELGHSVDQFVVLAHL
RSDLETDVAAVDGVDAVLGGHVHKERHEVVDGTLVVRPGANGQVVWEVELFNGNRSPIAT
RHSTAEGPIDESVADTTREQLDDVGLLETVATVDDPIHRDLDRRTCGESRVGNLVADAYR
WAADTDVSFVHNGGLRTGRPLSGEVTAGEVASVNPFGGRVDVLHVSGEQLRTLLQAAFRP
HREDGRLWHGDISGMTVEYDTEAGRLLGVAVNGQPIEASREYRLATNSYVAYSDDWPIPH
EATVDSFGLPFKAVADYAREEGLTVRVDGRLQEC
Download sequence
Identical sequences Q5UW63
WP_011224878.1.69175 272569.rrnB0326 gi|55380347|ref|YP_138196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]