SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55377012|ref|YP_134862.1| from Haloarcula marismortui ATCC 43049

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55377012|ref|YP_134862.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.72e-40
Family GHMP Kinase, N-terminal domain 0.00051
Further Details:      
 
Domain Number 2 Region: 189-304
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.09e-29
Family Mevalonate kinase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55377012|ref|YP_134862.1|
Sequence length 327
Comment mevalonate kinase [Haloarcula marismortui ATCC 43049]
Sequence
MVTSSAPGKVYLFGEHAVVYGEPAVPCAIERRVHVTATEIDEGLRIHANDLQLDGFTVEY
SGDGESHPDVDVAESLVEAGMGYVNEAVAQARDAADAPEAGFEISVEGDIPLGAGLGSSA
ALVVAAIDAATRELGVELSASDIADRAYQVEHAVQDGQASRADTFCSAMGGAVRVEGDDC
RRLEGIDTLPFVIGYDGGAGDTGALVAGVRDLRGKYDFAADTVAAIGDIVREGESVLGTG
DYERLGELMDFNHGLLSALGVSSRSLDSMVWAARDADAHGAKLTGAGGGGCIVALDETDD
ALTALKYTPGCEDVFRAELDTDGVRQE
Download sequence
Identical sequences M0KLP3 Q5V5P6
WP_007188244.1.69175 WP_007188244.1.84793 272569.rrnAC0077 gi|55377012|ref|YP_134862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]