SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|18818|e_gw1.6.276.1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|18818|e_gw1.6.276.1
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000919
Family SinR domain-like 0.044
Further Details:      
 
Domain Number 2 Region: 64-91
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 0.000000103
Family Cyanase C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|18818|e_gw1.6.276.1
Sequence length 96
Sequence
SFEDIGKRIGHDEVYVAAMFYGQTKPSQEELEKLSSVLNIPTSHLKEELGDQFFPDRGGL
VDLPPSDPTLYRLLEIIKVYGYPLKAIIHEKVWRYI
Download sequence
Identical sequences A0A167NX67
XP_018294846.1.77709 jgi|Phybl1|18818|e_gw1.6.276.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]