SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|65702|fgeneshPB_pg.12__335 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|65702|fgeneshPB_pg.12__335
Domain Number 1 Region: 116-211
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 4.53e-21
Family Barwin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|65702|fgeneshPB_pg.12__335
Sequence length 212
Sequence
MSSTLDIHSEIIDSNSNRQFITNEKKPTGILAGSYSSLPPATLWTRLSNRYRYGRLGLII
SGILGVFVVMFIIIGTLGVFKNELYRTRLGLPSVGKTKYKGSSTGTATEGDFNISGEGDD
PGVGITACGTQFTAQDYVVALNHVDYGVYANPNESPVCGACIEVTGELGTVKVTIQDMCP
GCEQGSLDLSPAAFSKIADISEGRVPVSWTPC
Download sequence
Identical sequences A0A162U4D2
jgi|Phybl1|65702|fgeneshPB_pg.12__335 XP_018290293.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]