SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|75429|estExt_fgeneshPB_pg.C_10080 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|75429|estExt_fgeneshPB_pg.C_10080
Domain Number 1 Region: 436-663
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-26
Family RecA protein-like (ATPase-domain) 0.018
Further Details:      
 
Domain Number 2 Region: 284-372
Classification Level Classification E-value
Superfamily DNA primase core 0.000000188
Family Primase fragment of primase-helicase protein 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|75429|estExt_fgeneshPB_pg.C_10080
Sequence length 715
Sequence
MSRLILQSKPLFRSLVRLPTGRYTKIRPTYAFSTTTSWKGNNTTRQVTGECAHTTPNDPG
LKKRKADMIEFLYQNHQRPVPTGKKDIVLTNCPHCIKIRKNSFAAYLDLAKSTYNCKTCG
TRGSWQEYTRTLKKKLTSNQTEPQLISASNVFGSHHSQFSRPIEQVEAYPERLAQDTDVL
EWLHTTYKIKPEVLRTYGVGLANYVDPDTRLREIQENKEVQESLCLTFPQTTLTYNPEAP
EDESSPEGTFKLDTIRIKASSLDTPSETLAYDPPVPNRSISAGLFGYKTVTFESDSVIIT
RRELDAMAIFQETGIPSVSLPSSNYQLEESVLPLLERFSKLYVWLDDDVDGQLAADRFAN
KLGDSRCMIVSTRINSPHGPVNAHGALLEGEDLRSILGSARQIKHDEIMDFSDLREEVYS
EIMNPEQTRGVQSKDLPGWNSLLKGHRSGELTILTGPTGSGKTTIISQLSLDYCQSGVPT
LWGSFEILNKRLAKRMLYQYSGKDLSTAPQEIDAWANKFEQLPLYFLKFFSSTAIKDVLK
ACSHAVYAHDVRHIILDNLQFMLSQQGRSSLDRWELQDEAIAELRRFATQQDVHITLVVH
PRKDIGEQLDINSVFGSAKVTQEADNVVIIQKPLKADGYRTLDVKKNRYDGTLGAMPYVF
MKDSLKIRCLNDKETAKPKRISKPRYPKSTYPSAVNRADHAEYPLSTEEIAGQIY
Download sequence
Identical sequences A0A167Q6T6
jgi|Phybl1|75429|estExt_fgeneshPB_pg.C_10080 XP_018297214.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]