SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|17328|e_gw1.3.829.1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|17328|e_gw1.3.829.1
Domain Number 1 Region: 267-344
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000193
Family PCI domain (PINT motif) 0.021
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|17328|e_gw1.3.829.1
Domain Number - Region: 80-207
Classification Level Classification E-value
Superfamily TPR-like 0.0303
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|17328|e_gw1.3.829.1
Sequence length 382
Sequence
MEIDFDIPKFLSQERHKAPANLQHYFSTFEDLYERKLWHQLTLKVLEFFKEPASGPFQIP
IYQQFVSQWEKQINALSLVSIALKAATHFKDPNDAVEFLEILVTKVDKPDTKDVHVHAVM
EAANFKLKLNQLDQVKKAIDSSEKTLESLDSVDTAIYASFYRVSAAYYKAKGEYAAYYKS
ALLYLACVNVDELSNEEKVERAYDLAIAALLGEMIYNFGELLMHPVLDALTNTQNDWLRS
LLFAFNSGDIGKFEALAPHFAKLPLLQENAASLSRKICLMSLIEAVFRRAGDSRDIPFSD
IAAETRLPVEEVEHLVMKALSLNLIRGSIDQVDQIVTVTWVQPRVLDKDQIDGMRRRLED
WDNQVKKISGFLSEQGGEVFAQ
Download sequence
Identical sequences A0A162URI4
jgi|Phybl1|17328|e_gw1.3.829.1 XP_018295692.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]