SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|22761|e_gw1.19.181.1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|22761|e_gw1.19.181.1
Domain Number 1 Region: 10-401
Classification Level Classification E-value
Superfamily Cullin repeat-like 3.66e-119
Family Cullin repeat 0.0000000149
Further Details:      
 
Domain Number 2 Region: 404-678
Classification Level Classification E-value
Superfamily Cullin homology domain 1.31e-90
Family Cullin homology domain 0.000000065
Further Details:      
 
Domain Number 3 Region: 680-768
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.45e-27
Family SCF ubiquitin ligase complex WHB domain 0.0000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|22761|e_gw1.19.181.1
Sequence length 768
Sequence
MGNLPPADSFKATWDFLEQGLDQIMNRLEEGLDFTRYTVLYSAVHNYCARGSPTSSHGVP
DPLSNPHSRRAAQLIGGDLYTSLSQYLEVHLQKIKTESERYMDEALLQYYTKQWERYTTA
ARVVNNIFMYINRYWVRRQIDEDRKSDVYDVFTLALVSWKKNMFEYVHHNVIGAVLKLIQ
RQRSGETIENGLIKSIVDSFVSLGLDSSDSTKSNLDVYREYFETPFVQATEVYYKTESEK
FISENSVPDYMKKAEARLLEEETRVSLYLHESTNKTLVPTCERVLVKNNSEVMWEGFKSL
LALDKQDDLRRMYSLLARIPDGLDPLRKSFEAHVKKAGLSAIERIAQQEGEVVDPKTYVD
ALLDTHRKYNDLVQNAFSGEAGFVASLDKACGEFVNRNQICKTSSSKSPELLARFCDSLL
KKSAKNPEENELEDVLNSIMTVFKYVEDKDVFQKFYTKSLAKRLVNGTSASDDAEGSMIT
KLKEACGFEYTSKLQRMLTDMSLSKELNDHFKELVQQSSQTTSSNVDFTILVLGAGSWPL
SAPSTDFNIPEDVFKVYDRFQKFYQNKHSGRKLNWLFQLSKAELKTSYLKASKAGYAFQV
SAYQMGILLQYNTATSYTYQDLQKSTALTPEALHPALSILVKAKVLLLSDGEKVGDDGSR
YSLNFDFKSKKVRINLNMQMRTEQKVEADETHKTIEEDRKYLIQAAIVRIMKTRKVMKHS
ALIDEVLTQLQSRFKPRIPDIKKCIDILLEKEFIERVEGQKDMYSYVA
Download sequence
Identical sequences jgi|Phybl1|22761|e_gw1.19.181.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]