SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|24508|e_gw1.30.20.1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|24508|e_gw1.30.20.1
Domain Number 1 Region: 328-422,460-491
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.27e-26
Family Regulator of G-protein signaling, RGS 0.0014
Further Details:      
 
Domain Number 2 Region: 215-295
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000933
Family DEP domain 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|24508|e_gw1.30.20.1
Domain Number - Region: 37-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00816
Family PadR-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|24508|e_gw1.30.20.1
Sequence length 497
Sequence
MPNSNNSLSTYTSMMRVTSTGRPFAKDLFDIFGAFLIQTPLKDHRSIFRTYPNSITTDEA
VLTLSDLKFVHVIRTPDPNDPNVQIATRTTTTFSMTREMAKTLGQHMLNSRLAENAADPQ
NRTMKDRATWYVTPKGKYMVQDFSQRAGVSISHIQKSLDRIDSFRIVKFDRLIDTDSLSF
ARPNMTTAFKTMMAWLPTETLLADDVGGLKEKQAHEYTYTFYGYQCFEWICEYTTVVSGE
EGLMIAAEFVLYGWIVQVLDKSDKSNSIRTDNNSFKTTKRAIYYVTERGRKVLGWQTKPT
RSPSDVSLSKQSDIASSSGNLGKTPRDSQWTRLRQILEDPLLRMYFRDFMKANFCEENIN
FWVDYYSLRKKARSRRMIISELLTDCYTIYDTYLGMQAASEVNIDHGLRQEIITLVTRTF
TVAPGSSLDMPFLNIPIQPTLINVTVNGSNQQCLQVIMRMYDKVNDHICRLMAQDSVPRF
VKTEKYQQFMSQNSTPI
Download sequence
Identical sequences jgi|Phybl1|24508|e_gw1.30.20.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]