SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|24773|e_gw1.32.22.1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|24773|e_gw1.32.22.1
Domain Number 1 Region: 361-460,487-518
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-25
Family Regulator of G-protein signaling, RGS 0.00091
Further Details:      
 
Domain Number 2 Region: 230-278
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000327
Family DEP domain 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|24773|e_gw1.32.22.1
Domain Number - Region: 10-125
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000446
Family PadR-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|24773|e_gw1.32.22.1
Sequence length 552
Sequence
MMKFTMDGRPFLKDIHDLFSALIVQIPIDNHRYLFRNYTNTFSSEDALQALGSLRFSHTQ
RASDPNDTTKQLWTTTTTTFNMARDMAKALCQQFHTCHLIENAVDSHNRVFREKGLWQLT
PKGLCVLQDFCVRTGADMTSMRKHFGQLDPIQLVRLERQAEDDELILSRQNLSIVFRVML
SLLPLEGELDQPGNHSSPVPPKTTSSTSSNSSVSSSSTTSSRREIIPKTANTIRTVFSSQ
MCCDWLVDYSTVSSRDEAEVIANSFIRYGWLEFQDHRLSGAFIKVSKATLLLVTDKGKQI
LNEKSLSIESESKNKDSHVKKEEAEKSKNKEGLETISKLSKSLSLQSISTTIIDHKEGNL
ARLRLILDDPQCRSLFKDFLRANFCEENLDFWIDYESLKRKCRSQSPALPSQNQKDLVED
AYNIWVTYLAPSAPSELNVEHSLRQEMARLVSSVVTVVPTYMPGQIKPTILISTSSASQS
LRMMLKWFDRVDEHICRLMASDSVPKFIKTSKYRRLQDSREKERQKRDTIREARARETRE
VLEESVSENSTL
Download sequence
Identical sequences A0A162N8N6
jgi|Phybl1|24773|e_gw1.32.22.1 XP_018284914.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]