SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|26768|e_gw1.67.7.1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|26768|e_gw1.67.7.1
Domain Number 1 Region: 326-387
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000012
Family PCI domain (PINT motif) 0.058
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|26768|e_gw1.67.7.1
Domain Number - Region: 127-246
Classification Level Classification E-value
Superfamily HCP-like 0.00034
Family HCP-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|26768|e_gw1.67.7.1
Sequence length 465
Sequence
MESIEIKRNFTLLERAVDTLESRFTTRVLRTVPSIRRRLTSPVLAQVISETYEYNIDEEE
KNELLQYLGEKSNDMEVDSAAEKNGSVLPEIDTYLHLHVLITLLDKNELKKGTELADKTV
KKILLLNRRTLDQLAARVYFYHARFYELTGRLAEIRPLQLAAHRTATLKHDDETQATLLN
LLLRNYFVHNLYDQADKLVSKCAFSENAGNNQAARYAYYLGRIKALQLDYTSAHTYLTQA
IRKAPQNNITAGFQQTVNKFFIVVQLLMGEIPERSLFRQPILKKALAPYLHITQAVRIGD
LSKFQECLAQFDAVFKKDKTFTLILRLRHNVIKTGIRMISLSYSKISLRDICIRLHLDSE
EDAEFIVAKAIRDGVIDATLDHSRGFMKSKEILDIYSTNEPQHAFHQRISFCLNLHNEAV
KAMRFPLDAHRKELASAEEARERERELAQEIAEGDLDEDNDMADY
Download sequence
Identical sequences jgi|Phybl1|26768|e_gw1.67.7.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]