SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|27196|estExt_Genewise1.C_10038 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|27196|estExt_Genewise1.C_10038
Domain Number 1 Region: 7-222,296-324
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 5.63e-79
Family Creatinase/aminopeptidase 0.0000000274
Further Details:      
 
Domain Number 2 Region: 222-295
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.39e-23
Family Methionine aminopeptidase, insert domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|27196|estExt_Genewise1.C_10038
Sequence length 325
Sequence
MRAAERIKEDEYDQLRRAAEVHRQVRAYAQKAIKPGMTMIEICELIENGTRALVEEDGLE
SGIGFPTGCSLNHCAAHYTPNAGDKTVLSYDDVMKIDFGVHVKGRIIDSAFTMAFNPKFD
PLIEAAREATYAGIAAAGIDVRLCDIGAAVHEVYDSYEIELDGKNYDIKPIRNLNGHTIE
PYRIHAGKSVPIVRGSSDETKLEEGEQLAIETFCSTGRGYVVEDGECSHYARSTESPFVP
LRLPKAKSLLANINKHFGTLPFCRRYLDRTGEEKYLMGLRHLVDAGVVTAYPPLCDTKGS
YTAQLEHTILLRPTCKEILSKGDDY
Download sequence
Identical sequences jgi|Phybl1|27196|estExt_Genewise1.C_10038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]