SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|28819|estExt_Genewise1.C_30462 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|28819|estExt_Genewise1.C_30462
Domain Number 1 Region: 316-398
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.01e-18
Family PCI domain (PINT motif) 0.026
Further Details:      
 
Domain Number 2 Region: 110-327
Classification Level Classification E-value
Superfamily TPR-like 0.000066
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|28819|estExt_Genewise1.C_30462
Sequence length 423
Sequence
MVTATAPTSDRLRQAEELSKGNNLDQSIALYKSILAEKVNTEDVLREQEVALIRLGEVYR
DLKLPQELASLIRSSRPFMSSIAKAKTAKLIRTLVDFFGDIKNCLPLQIEVCKESIDWCV
KEKRIFLKQSLETRLVALYLDNKMYHESLSLTAQLLKELKRLDDKMVLVEVQLLESRVCH
ALRNFPKARAALTSARTSANAIYCPPLLQAALDMQSGILHAEEKDYKTAYSYFFETFEGY
SSQDDPKAVLALKYMLLCKIMLNLTEDVHSIIGGKVALRYAGSEIEAMKAVANAHQNRNL
QEFETALATYTEELNNDPIIRSQLAALYDTLLEQNLVRIIEPFSRVEISHIADMVKLPTQ
QVEAKLSQMILDKAFHGILDQGAGCLIIFDEPEEDKTYESAIETLKQVDKVVSSLYQKAS
NLS
Download sequence
Identical sequences A0A162UT20
XP_018295773.1.77709 jgi|Phybl1|28819|estExt_Genewise1.C_30462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]