SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|29341|estExt_Genewise1.C_40416 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|29341|estExt_Genewise1.C_40416
Domain Number 1 Region: 339-412
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-16
Family PCI domain (PINT motif) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|29341|estExt_Genewise1.C_40416
Sequence length 443
Sequence
MSDDDFMLEDDDQDYDFDYEDGSDDEEPDVDLENKYYNAKARKEDDPEGAISEFQSVVDT
EEEKGDWGFKALKQMIKISFQLGKHEETLKYYHELLTYVKSAVTRNYSEKSINNILDYVS
TADNMSFMEKFYQTTLDSLLETKNERLWVKTNLKLAKLWLDRKEYGRLNKILRQLHSACQ
KDDGTDDQRKGTHLLEVLALEIQMYTETKNNKKLKELYQQCLHVKSAIPHPRIMGVIREC
GGKMHMGEKQWDDAQTDFFESFKNYDEAGSPQRIQVLKYLVLATMLTESQINPFDSQETK
PYKNDKEIAAMTSLVSAYQKKEIREFEKILKTNHNSIMGDPFIRTYIDDVLKNIRTQVLI
KLIKPYTRIELGFISKQLNIPVEEVEELLVGLILNEKIAGRIDQVNARLELDRRLTDALR
YEAIDKWSNNVSCLGKTVIGKAT
Download sequence
Identical sequences A0A167R3L1
XP_018298804.1.77709 jgi|Phybl1|29341|estExt_Genewise1.C_40416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]