SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|32891|estExt_Genewise1.C_240037 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|32891|estExt_Genewise1.C_240037
Domain Number 1 Region: 36-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1e-17
Family RPO3F domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|32891|estExt_Genewise1.C_240037
Sequence length 281
Sequence
MDVTEAHLAMNTLLKKSAIEIMSLNGENLLRAIDLKDAEKASKLDEEGRLVFNAIRAAGN
VGIWTKDLKKKTNLHMIVLNRALKLLEQKHEIKAVKHVKFPTRKIYMLFNTTPSSEVTGG
AWYTDQELDTDFIDSLKAACLKYITARSFPRNETVRDAVFGADHEHYPTATEVRRFITES
RISSIELSVKDITSLLDVLVYDGTIEKKSPFAIGMEDFSDEEDGDENVQWSYKAVRKTTS
RLPVEALTEVPCGRCQVFTFCSENGPVSPFNCEYFKVWLDW
Download sequence
Identical sequences A0A167M829
XP_018290119.1.77709 jgi|Phybl1|32891|estExt_Genewise1.C_240037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]