SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|33292|estExt_Genewise1.C_280011 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|33292|estExt_Genewise1.C_280011
Domain Number 1 Region: 79-177
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.99e-33
Family Heat-shock transcription factor 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|33292|estExt_Genewise1.C_280011
Sequence length 177
Sequence
MTSDRRDSSRSSSSIRSSISGTSNASDSEGLGLRFAKSKSMENGEMSDMKGHNVAINLSR
SNSNDYTILSTSPNTKTQAAFVNKVYKMLEDPEIQELISWSRSGDLFSVANPTVFSKIVL
PQYFKHNNWQSFVRQLNMYGFHKVNDMIHSNLTNETQTWEFRHPHFRRGAVDDLQNI
Download sequence
Identical sequences jgi|Phybl1|33292|estExt_Genewise1.C_280011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]