SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|33757|estExt_Genewise1.C_340103 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|33757|estExt_Genewise1.C_340103
Domain Number 1 Region: 51-395
Classification Level Classification E-value
Superfamily Cullin repeat-like 7.85e-84
Family Cullin repeat 0.00000123
Further Details:      
 
Domain Number 2 Region: 395-666
Classification Level Classification E-value
Superfamily Cullin homology domain 1.83e-82
Family Cullin homology domain 0.000000359
Further Details:      
 
Domain Number 3 Region: 674-753
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-22
Family SCF ubiquitin ligase complex WHB domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|33757|estExt_Genewise1.C_340103
Sequence length 755
Sequence
MVIDSTPLVLNSKPIKESETPGKQARSKFMSPVHTNAKLLWDSKPSVTTGEEYLKDAWNT
HEALIKSILSGKTISSGMNDAYIKCEILCRDGRSAVIYSRVKNVLSRHIDGLAKNLGEMA
SSYDNFLQYTNKCWNQLSFDLHQLKKLFMPMDRSYIVQSTEYDSIIDLGYSLFKDNLVKN
DAIKERLVANILYYVKVERDGGTVDQPLIKSLLQMLMTLSLYSTIFEPRFIEETARYYEQ
EGRSLIQKIDIPNYLVHVTRRVKEEGEDRKQAYLDKSTEIRLVQTVKNELVYRMTNDILS
KGFDSMADEMKLESLKTLYDLLSPEKDRTELRQVFGSYIKKRGIEFIKDPSNDNAMIVTL
LDRKQRADTIMEKCFDNNILFANTVKESFETFINSRNNKPAELIAKYIDSKLRMSEKKKA
EVDMEKVLDDALAIFRFTQSKDIFEAFYRRFFARRLLSTFDVSEEAEMSMITKLKSECGP
DFTKDLEIMFKDMSISSELQAKFREATINTDVYDKTMNVIILTSSAWPNTPKHEAILPPK
LAESQEVFKQFYVSKFKGKKLTWHNALGQCILRVRFPRGVKELSTSLFQSIVLFLFNDET
KETISFPEIATATGIDEKELRRVLQSLACGQSQVLTKTPPGTEVKDTDVFAYNADFSAAR
PRVKISPIISDTSAEENKDTENSVLFNRQCQIDAAIVRIMKAKNKLSHGALVNELFATLR
FPINASDIKKRIESLIEKEFLLRDEEDNSAYIYNT
Download sequence
Identical sequences A0A162NHU9
jgi|Phybl1|33757|estExt_Genewise1.C_340103 XP_018287844.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]