SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|33958|estExt_Genewise1.C_390054 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|33958|estExt_Genewise1.C_390054
Domain Number 1 Region: 684-758
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000326
Family PCI domain (PINT motif) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|33958|estExt_Genewise1.C_390054
Sequence length 796
Sequence
MSRFFRSASDSESDSESSDNESFISDDLSDNEVDSEGEEEKQQDDQPKKSRFLKGTGDDS
DDDSDNEFGGKRQVKSQKDKRLEEMQGSVKAIENGQKNSDWTRITNEFDKLAVSVTRATT
GFDSIEVPRFYIKVLSDLDDFMQETLQKEKSAKKKMSAGNNKAVNAMRQKLKKINKQYEK
SIAEYKKDPEAFMVEEEEEEIPEPIVKKKVTPSEKVSSVETEAVDDGFTSVGKGGKAVVE
VTNETLLTKLRETLENRGKKNTDREEQVAVLEVLLQKSKSPFQKISVLLALISSRFDINL
SMVEYMQLKLWKSVEKELNLLLEVLEANPAFVVCENAEDLDNEDKDITPAAGETIKIRGS
IVSYAERLDDEFTRSLQHIDPHTTEYIDRLRDEPSLYAILVRTQSYFEEYQMKDNISRVL
IRRLEHIYYKPEQVIRSIESATKELLPKYISSKITSSEDPTQLIHQICSYLYKQSASVLR
TRAMLCHIYHFALHKDFHTARDMLLMSHLQESIHQADINTQILFNRTTVQIGLCAFRDGL
IKEAHAALQEIQGSGRVKELLAQGIQAPRYGQQATPETDQLERQRQLPFHMHINLELLEC
VFLTCSMLLEIPAQAQAGPNNKKFISRPFRRLLDYNERQAFSGPPENTRDHIMSAAKALA
SGEWEKARDFILAIKVWDLMPETQDIKDMLVRKIQEEGLRTYLFTYASYYSTLGLSQLSV
MFGLPVSNVSAIVSKMIWSEELSASLDQVSQCVVLHQVELSRLQVLSLQFSEKAANLVDQ
NERLAGVGRDNSKNHN
Download sequence
Identical sequences A0A162ZEY3
XP_018284341.1.77709 jgi|Phybl1|33958|estExt_Genewise1.C_390054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]