SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|34443|estExt_Genewise1.C_510051 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|34443|estExt_Genewise1.C_510051
Domain Number 1 Region: 94-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-30
Family RIO1-like kinases 0.00028
Further Details:      
 
Domain Number 2 Region: 6-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.54e-22
Family Rio2 serine protein kinase N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|34443|estExt_Genewise1.C_510051
Sequence length 356
Sequence
MKLDAKALRYMSSDEFRVLTAVEMGSKNHEVVPTSLIAQIAQLRTGGSHKIVGDLAKTKL
IARVQNSSYDGYRLTYGGYDYLALKTFAKRGTVYSVGNQIGVGKESDIYLVADEEDNQHV
LKLQRLGRMSFRTIKSKRDYLQNRKSASWMYMSRLAAMKEFAFMKVLHENGFPVPEPIDY
SRHCVVMELIDAFPLRQVDEVGNPGKLYSELMNMIVKLAQYGLIHGDFNEFNILIRSNGE
PVLIDFPQMVSTSHINAEYYFDRDVDCIRTFFRRRFGYESVLYPKFKLDVNREFSLDVQV
AASGFTKKMQKELEQFQEEFKAESGDEGEEVDSEEEDEEEEEEEEEKAEPALTEED
Download sequence
Identical sequences jgi|Phybl1|34443|estExt_Genewise1.C_510051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]