SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|35182|estExt_Genewise1Plus.C_10481 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|35182|estExt_Genewise1Plus.C_10481
Domain Number 1 Region: 4-142
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.9e-58
Family Rps19E-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|35182|estExt_Genewise1Plus.C_10481
Sequence length 146
Sequence
MTGITVKDVNAHEFIKAYSAYLKRTGKLEVPKFVDIVKTGSYKELAPYDPDWYYVRAASV
ARHIYIRKSVGVGALNKVHGGRINRGFRPSHHVEASGSVNRKVLQSLEKIGVLEQDKKGG
RRITQDGQRDLDRIAMTLVASEEDDE
Download sequence
Identical sequences A0A167QFQ2
XP_018297669.1.77709 jgi|Phybl1|35182|estExt_Genewise1Plus.C_10481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]