SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|37013|estExt_Genewise1Plus.C_40283 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|37013|estExt_Genewise1Plus.C_40283
Domain Number 1 Region: 408-682
Classification Level Classification E-value
Superfamily Cullin homology domain 9.94e-90
Family Cullin homology domain 0.000000667
Further Details:      
 
Domain Number 2 Region: 20-412
Classification Level Classification E-value
Superfamily Cullin repeat-like 2.88e-84
Family Cullin repeat 0.0000122
Further Details:      
 
Domain Number 3 Region: 686-774
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.57e-27
Family SCF ubiquitin ligase complex WHB domain 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|37013|estExt_Genewise1Plus.C_40283
Sequence length 774
Sequence
MSYRKIRIKPPTRLPNVDREQEYEDGFKLLSQAYIEIFRKNAKILSYEVLYRTAYNLTFQ
QFGEKLYFGVKDVIANYLEAKAEGAIVPAFVNTSSTKESSAAGSDSSAMFMNTVKLVWDD
YVTALTMIRMTLKYLDDRLPKYNLPNVTDMGLDLFRDRVIRSDKYPIQAQLIAAMLNQIQ
LERHGDVIDRSVIKAAVSMLSELTDPTTKESVYIVDFENKYLETSAAFYQIESEVLSTSY
DAPEFMRKVERRLEEEYERTIHCLSLVTEPKIRHIVETHLITDNLKTVIKMKNSGLDSML
NADKYGDLLRMYKLFSRVSAGLNELRTAMMAYILRIGAEINRSIAADIGDMNKPKSVAEK
SAVGGAQVAIRWVEQVLNLQEKFDRILEFAVNNDKSFQTVFNEAFESFINDNTKSAEFIS
LFIDENLKKGLKGKSEDEVDDILGKTITLFRFLRDKDVFERYYKQHLAKRLLFNRSVSDD
AERGMLAKLKRECGYQFTNKLEGMFNDIKLSAEMDVQFKDFSDRQPFVDVGVTVLTSTFW
PMNISSSPKCNMPQVILGACESFEKFYFDRHSGRRLTWQPQMGTADIRATFKSCRPMLNL
STFAMIVLLLFNDIHEDNGLSLEEIKGQTQIPEAELKRTLQSLACAKYKVLTRNSKGREI
HPGDIFYFNTSFSTNLAKIKIQTVASKVESEGERKNTQDKVDEERKHQIEAAIVRIMKDR
KSMEHNLLIAEVTKQLTPRFLPNPVMIKKRVEALIDREYLERSSEDRRSYRYLA
Download sequence
Identical sequences A0A167R0Y8
XP_018298637.1.77709 jgi|Phybl1|37013|estExt_Genewise1Plus.C_40283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]