SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|39715|estExt_Genewise1Plus.C_160204 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|39715|estExt_Genewise1Plus.C_160204
Domain Number 1 Region: 332-430,472-502
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.62e-21
Family Regulator of G-protein signaling, RGS 0.0026
Further Details:      
 
Domain Number 2 Region: 217-291
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000223
Family DEP domain 0.0085
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|39715|estExt_Genewise1Plus.C_160204
Domain Number - Region: 25-133
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00544
Family Rio2 serine protein kinase N-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|39715|estExt_Genewise1Plus.C_160204
Sequence length 512
Sequence
MPNTLRSLSTYTTMMRVTSAGRPHCKDLHDILAAFIIQMPLSDHRTLFRTYPFSFTTEEA
VEILGHLQFTHVHRGPDPLDPTRHVSTRTTTTFSMTSGMAKTLCQQFLQARLIENASDPS
NRLIRDKAIWCPTPKGKCMIQDFSIRAQISIDHLTACLDKLKTISVVTLDRQNNRDNTLA
FSRPSVSLAFQLMTQYVPCDVLLTDEVNGVDTRIAKNTQYTFYGSQCIDWLCEYTTVVNR
EEAEMIGSEFILCGWIKCLTDKPPGGNDIIFRSSRNAIYHITDRGCQCLGWNGYTTTITP
GSPQSFDIIPLARPLSISYGNPTDNDLKLKASYYSRLQNILDDALLRMYFREFMKSNFCE
ENLCFWVDYNRVEKKWISAADSIVVRRQVWANDCFQMYMTYLSPCAPSEVNIDHMLRQDI
IRYATAYFINQAGMAGTHAPFSTALHPISFLTNTNNTNNRLPEECLQELIEMLRCVNEHV
CRTMAQDTVPKFVQTQKYQEISQRNKSQDIKD
Download sequence
Identical sequences A0A162WND0
XP_018287255.1.77709 jgi|Phybl1|39715|estExt_Genewise1Plus.C_160204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]