SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|40491|estExt_Genewise1Plus.C_220097 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|40491|estExt_Genewise1Plus.C_220097
Domain Number 1 Region: 677-749
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000299
Family PCI domain (PINT motif) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|40491|estExt_Genewise1Plus.C_220097
Sequence length 793
Sequence
MSRFFRSASDSESDSESSDNESYISDDDHESTDDEVEQEELGEAQPKKSRFLKGTGSDSD
SGDDEFSRKRQVKSQKDKRLDEMENSIKAIESGQKNNDWGRILAEFDKLSLHVTKAVTGF
DSIPVPKGYIKTIVDIDALLQESKNSKKKLNVTNSKAMNVMKQKMKKITKQYEDLVAEYN
KDPEAFMEEEEEEEIIEEKPEPVKAPVAQIIDEEEDDGFTSVGKGGKRMVELTADNFFST
LKEVLENRGKKNTNRDDQIVTLQRLLKSARSPFQIISVLLLLISSRFDINLSMAGFLPVP
VWKAAEKELNLLLETLEKNPQFVVREDAEPLDEDDKDITPAPGQVVALRGSIVSFIERLD
DEFTKSLQNIDQHSTDYIDRLRDEPQLYTMLVRVQIYGEKYNMDNTVSRVVMRRIDHLYF
KPDVVIRSIESSAANLLSKNLVSKIITSEEPSELIHQLCAYLYRQKASALRTRAMLCHIY
HIALHKQFYTARDMLLMSHLQESIHQADITTQLLYNRAMVQIGLCAFREGLIKEAHAALQ
EIQGSGRVKELLGQGIQTPRYGQQTAPEVDQLERQRQLPFHMHINLELLECVFLTCSMLL
EIPAQAQAGPNTKKYISRPFKRLLDYNERQPFSGPPENTRDHIMSAAKALASGEWERARD
SILAIKVWDLMQDTEAIKEMLVQKIQEEGLRTYLFTYAPYYSTIGLEQLASMFALEPTRV
SAIVAKLILNEELSASLDQVSKVIVLHQVELSQLQVLALQFADKAASMVDQNERLSTGGR
ENQKNHTHHHHHS
Download sequence
Identical sequences A0A162TE98
jgi|Phybl1|40491|estExt_Genewise1Plus.C_220097 XP_018285952.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]