SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|56018|fgeneshPB_kg.13__8__4333556:1 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|56018|fgeneshPB_kg.13__8__4333556:1
Domain Number 1 Region: 35-163
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.3e-26
Family Single strand DNA-binding domain, SSB 0.00068
Further Details:      
 
Domain Number 2 Region: 183-247
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000171
Family C-terminal domain of RPA32 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|56018|fgeneshPB_kg.13__8__4333556:1
Sequence length 249
Sequence
MSGFFSQSTQASKGGYDSHGGDDGTAKKPTADQTLRAVTIKQINTATILPDSKFKIDDAE
VANITFVATIRKVTEQASSTNYTVEDGTGAIDVVFWGNQTDTEEILAKRREMTVNTYVRV
FGRPHSFGKHTNCSAFTVRPIVDFNEIAYHFIECVHSHLTFTKSSKSSDIQVVSSGNANT
SGRALNDQIISYIESCGESSDGVHIEDIINKLRGLHTATSVRTALENLTNEGHCYTTSDD
YHFKSTANY
Download sequence
Identical sequences A0A162NDE4
XP_018291328.1.77709 jgi|Phybl1|56018|fgeneshPB_kg.13__8__4333556:1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]