SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|57894|fgeneshPB_pm.36__21 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|57894|fgeneshPB_pm.36__21
Domain Number 1 Region: 8-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.26e-34
Family Rps19E-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|57894|fgeneshPB_pm.36__21
Sequence length 130
Sequence
MTGITVKDAYSAYLKRTGKLEVPKFVDIVKTGSYKELAPYDPDWYYVRAASVARHIYIRK
SVGVGALNKVHGGRINRGFRPSHHVEASGSVNRKFSSPSRRSVSWSRTRRARDLDRIAMT
LVASEEEDDE
Download sequence
Identical sequences jgi|Phybl1|57894|fgeneshPB_pm.36__21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]