SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|59835|fgeneshPB_pg.2__555 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|59835|fgeneshPB_pg.2__555
Domain Number 1 Region: 1231-1344
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.52e-24
Family DEP domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|59835|fgeneshPB_pg.2__555
Sequence length 1770
Sequence
MPVLPTTTSAPIPWLSTKPVILWFHDPGVVFTQDAVINPDHFPNIRDGQLLRIHFPRSGS
HPPVTLPGPTSPQQSGNSLSQPFSLAQFERDPLIVKAACVDRELLVRQQHLQISVSRDIA
ERFNIRFRPEVYVELIDSSSVTLSHVELWFKEQYLGRSDMWRLQQSLKGACVYVEKKLVF
AGVIKATVKKLYNDGQEVSSGYISDSTRMIFRSGSAKYFVYIQMSREMWEFDEDGELYFE
KVVNNFLPQLFQRWKDMGTNHVVSIVLFTRVFYDADDPLDNMVNQAEDGRFYKDFYKVLA
DWETTDDWMSIIGPLKKEQLKFQQQVLTRTDDGKTIVCGRMGMAFEGNLLEAVNLALNPF
EKHYVDRDLMRTGLSIILITPGAGKFSVNKKLLRLTNERMTDNGIAMDLVCLSPLPLHIT
PLLFYISSALPDDIESCATPRYSKNTMGNSPDKNSSGKKVAAQTDPLYRDDTSTTTQTYC
SIPHWIDCSFYHHETGRFLKQDKFKTRCKMYELQMMGIMEHDIATISVPSLAEQFPKSSS
ASIIKQQRSSSSLNDKLTLRSEDHAAFSGAPVEGYLSRSANFPSNPRSSYITTSDDIPSF
KAILPSSTDYSTYDSMVFKDSLEPRFNRRIPPVKLHSAPKQTSSGTHRSSFDGPDRQETD
QWQGNNTRTCAVKSSTTWHHGDQRRLTSIMSQSQQANGKITFNSPVRRDDQVTKGSDPFK
GSPTLAREDVYTRFRSARRGTMNSNDTKFPNTTDPGQQIDRLLVPEDDDSVLVSSSTVDP
VPINNKGFGRMDSRKTAGGHSPRQPIISGSMPSLHKQSANSDIRTSIGGVGPNRSSPHNT
NRPTNSRILLINPCNPADQAMAFTSYLRRWQHALPKAEKHDGPVVYWKSLSNPACLPLTT
DYFPSPEERATFYELFMYTVSASEDVNLYQAGDHTLSERKRTENLLTEMLSQRLAQGFQI
IVDSTGSETYSKKSTMENQTKDKEAGMTAGSNGHTNTKTAMGSLQDEPDRSKWNQRMYWL
SMGHQVHQVTFDSSGQNVEVRRYVRIISFDLKKIIYTCAIWPKHLPGYRPKNVAFNYPSI
SYGWNYLDHLVAGYQENLTDNLRFWRARFIIIPREQLPPNVMVPGMSHDHLDDEEKRLAL
FDTWIQNIRKVRWWTPKEKEEMQTKRKKELCISDFGPKLTTMDSSAYLTSEVANSVGNSI
GESLVSQHNSLLSSIGSLGQPLGLSKESKSKDIVIAMRDFKEGLKIKDRRWHFRMFRNAF
VGSECVDWIVSQFDDISTREEAVAFGNSLMARKPPLFVSSTDRHGFLDGHYFYRLHDEFT
PGQQKAWFLNNSTQSSRRSTTTSLATHHSGGKDSKESSNLNEKTGARPSVNRDVEEPVIF
EMSRSMIIDVDPYKKSDRRETAILHYDTLHNPKNCYHLQINWLGCTAQLIQELLQNWSRQ
AERLGLKVVEGSVEQAYEESENNNPFQCPVPISFAVAPPSVSEINPKYEVPDQFYAIALV
RHMGFVLDVEADSRFDKAKAEGIKLKYSYVKEPYKYDQYVHRSGVAFVQIRPDNQGFFWV
NNRLYTNHTPALVARRRAETSTLMHPDVLRTTFQARCNDRAWLTEFFETTRAQLVHPTEH
EDSLGSWVLENVRAIDDLATEDTEHDLVLDPISPTIAVSSGASTMPFVTASQSSTTNTST
TTTTTAAATATAAATATYTVTATATASNVTGGTNAANVTIGPSSAPTTAPLSTGIASGPN
TTSIADESHGGPSSLGVLDVTHFSTPPTSI
Download sequence
Identical sequences A0A163AWR8
jgi|Phybl1|59835|fgeneshPB_pg.2__555 XP_018294341.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]