SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|60026|fgeneshPB_pg.2__746 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|60026|fgeneshPB_pg.2__746
Domain Number 1 Region: 534-578
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000843
Family Rad21/Rec8-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|60026|fgeneshPB_pg.2__746
Sequence length 581
Sequence
MVDLVSVRRAMNLGSNVKASHPSKKDLVNMNIPLLCDTLSTPNSKLALRVTAQLLVGIVK
VLQHQHYCVYEDTVQLWTRICRESALMTIEDIDMPLATARQSSITFSEREFGQLGIDYKN
SVFSLLLRYEPFPQQDEEYICADQEVSRPEYEDQTVSQMNTSAAQEPSRLSVSLESDPLR
TDAMEIDILDQEPSIPQDYLYEGDHYYLDQPEPPTSSINSISEHQATVLPLEIGRFSREA
ADILTDIRLNNKSPISRRRSTSTGSTFSEQVAPFDIPEIEYNPRQASEGWDQSTTDTENN
PALVPQLLHNLPVPRLRQRTSVRSSTILLPLDFYEKSRLKTLGFGDQRQTHKVWIFIEMI
RLAIIAYFDPFYLIRIIVCTVSTPLHSLLNHENRTSFFKSMRPRLHNNTLVSPEYARRYR
SSESLNEDYSAGTLYSANEHMGILEFQDGTDSEETLALEESNQRYRRSNSPSFGHPSSID
IQYSPSPLDLQYEGVEYGDSFPNTLGGASAIIEEHLSSSSRNACALAGKTYIEFEQLLYD
GQNCPRSQVAHVFYQLLVLASINKLDVVQSEPYGCIKFRAQ
Download sequence
Identical sequences jgi|Phybl1|60026|fgeneshPB_pg.2__746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]