SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|60632|fgeneshPB_pg.3__257 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|60632|fgeneshPB_pg.3__257
Domain Number 1 Region: 342-422
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000326
Family TrmB-like 0.067
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|60632|fgeneshPB_pg.3__257
Domain Number - Region: 158-187
Classification Level Classification E-value
Superfamily TPR-like 0.0569
Family BTAD-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|60632|fgeneshPB_pg.3__257
Sequence length 462
Sequence
MAKFTEDPLLDLAVKERNIFDFLLRSLIITGIITTMSESLIGHQNHLDLESYIATYQGHT
RIARALFIAAKCPSLEIDAYRLALSDIKEITNDTTKYLHCVDELNNALKKQNSHPMEIDT
EWVKSTQISNKKTMEQLQSELRTYKAGLISESIRVTQTRMGDFYYACGDIPNALKSYHRV
REHCASNKHVIEMCFNVIKANITANNFASVRTYIARAETTPDLPNKTITLAKLKCCNALF
LLSAEEDAKYGTVAKALTEIPAEANGSFSDIISPNDVAIYGGLCALASFDRSQLRSLMVN
QGFRSYLELEPQIRDIIEAFQDSKYSACFDLLSSYRNDLLLDMYLNPHVDILFGHIKEKA
MVQYCAPYSTVDMRRMANIFKMSVDSLEDDLVSLIGDSDRISARIDSYEKILYTVRPESR
NQAFKRSLRAGKEYERSTKALMLHLNLVSKELCSGGAESSIN
Download sequence
Identical sequences A0A167P965
XP_018295539.1.77709 jgi|Phybl1|60632|fgeneshPB_pg.3__257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]