SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|61422|fgeneshPB_pg.4__97 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|61422|fgeneshPB_pg.4__97
Domain Number 1 Region: 13-167
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-46
Family Vacuolar sorting protein domain 0.00019
Further Details:      
 
Domain Number 2 Region: 168-231
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000381
Family Vacuolar sorting protein domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|61422|fgeneshPB_pg.4__97
Sequence length 235
Sequence
MSMLTQKDFQQVGDSIAAKELEQLQSQIEVFKSNLEEFAWKHRKDIRKDPTFRSHFQRMC
ATIGVDPLASNKGFWADLLGVGDFYYELGIQIIEGCMATRTRDGGLTELGDLKRRLDNAR
SKEGRQEKQDITMDDIVRAIKTLKPLSGGFEVLEIGERKMVRSMPKELDKDQSALLLLAQ
KQGYVNRPMIQQSLGWEDARTQTGLQHLLQDGLAWIDDQAEVDTYWIPSYFKLDE
Download sequence
Identical sequences jgi|Phybl1|61422|fgeneshPB_pg.4__97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]