SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|61825|fgeneshPB_pg.4__500 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|61825|fgeneshPB_pg.4__500
Domain Number 1 Region: 114-238
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000034
Family Heat-shock transcription factor 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|61825|fgeneshPB_pg.4__500
Sequence length 800
Sequence
MDHPLNYRSHHPQSHFSMHAFSAVGMPPPHPEDPDNSMHTSPTTTSSLSNPFPMADAPQE
DYSTIDPNMSRSMSLVMRRPLSQDHWDMPGHPMSHSFTAQDLDTMDINHSERGVAGFVSK
LYQSLQEPENEHKYVRWCTHDGKDMFIIDCIPSKSSSSIFAIFTMSHQSHLEFTQIVLPR
LFKHCKFASFVRQLNIYGFQRDTDARKSKDTKVKEKCRWHHPYFRPGRSDLFHLIRRKPT
RYSRRKRVKPEDPETIVNVGSGGEEESDNDEIASQSNDDGCQSSSVSSSSVSARQVKQEY
AATQSQLDMIYESDSQELPLSPTQICNTQQQYNSDNSNCSLGSHNSSGNASASGRLMTGG
IMSYSNMSGHNKADDQLSISGLRHEGNCSQPDLATLQQQQQAQAQLQAQQHAQQLAQQLA
QQQAHAQAQVHAQVQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA
QAQAQAHAHAQAQAQAQAQAQAHAQAQAQHHHQAMLHNHQQSRQALHQSNTHPINPQQTT
LRENELYMQLIQMKQECAKMQHFYNDHMRKANIQLEEQRHRIQELESMYNQRIELDAPQS
VFQFGGQTYAQVAPTLAAPYDGGVSGSNGGLMQRSKEEFDGRLKKDFYDGSGGSSTSTNA
NANASGGGGGNDSGDLADPSFVPNNPSPPRNSVFDSTPNTPTRPDLFTPSYPTTTQPLSP
QTSLQYDFLFPPVPINRALQATDRSCQPLSDRPPTEGSNEAWMAAATHYRQDSLPRPNAT
CPTPPDLHATYDSTFPVCIT
Download sequence
Identical sequences jgi|Phybl1|61825|fgeneshPB_pg.4__500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]