SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|62239|fgeneshPB_pg.5__77 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|62239|fgeneshPB_pg.5__77
Domain Number 1 Region: 851-1149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-53
Family Tandem AAA-ATPase domain 0.00026
Further Details:      
 
Domain Number 2 Region: 310-524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.74e-45
Family Tandem AAA-ATPase domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1153-1362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-45
Family Tandem AAA-ATPase domain 0.0023
Further Details:      
 
Domain Number 4 Region: 645-820
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.62e-40
Family Sec63 N-terminal domain 0.003
Further Details:      
 
Domain Number 5 Region: 52-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-33
Family Tandem AAA-ATPase domain 0.00098
Further Details:      
 
Domain Number 6 Region: 524-629
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000256
Family RecQ helicase DNA-binding domain-like 0.068
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|62239|fgeneshPB_pg.5__77
Domain Number - Region: 1362-1447
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00299
Family RecQ helicase DNA-binding domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|62239|fgeneshPB_pg.5__77
Sequence length 1456
Sequence
MDILGFDSQDLRQARENALIEASQAPLFSSNYKTKAEETYPHVYQSAKSGSMLSLFGTRY
ALPAGTVKEEFNDYEETIIPVPTQAPIRAGERRIKIEELDSLARGAFKAYETLNRIQSIV
YPIAYETNENMLVCAPTGAGKTDVAMLTVLRCLYQYCSTPPQKGSTEIDFTIAKNDFKIV
YVAPMKALAAEIVEKMGKRLKFLGVSVRELTGDMQLTKAEIMATQFIVTTPEKWDVITRK
GTGDVELAQAIHLLNEDRGAVIESIIARTLRQVESSQSLIRIVGLSATLPNYLDVAAFLR
VNPYQGLFFFDGGFRPVPLEQHFLGIKGKANSVPSNERMNRACFDKVSDLVREGHQVMVF
VHARKETVKTAQMLKEEVLNESLGDYFDCSAEPKFVGHRRDIAKSRNKEMKELFPYGFGI
HHAGMLRSDRSLTERMFADGCLKVLCCTATLAWGVNLPAYAVVIKGTQVYDSQKGSFVDL
SILDVLQIFGRAGRPQYETHGVGYILTTHDKISHYVSAITQQHPIESKFIENIVDNLNAE
ISLGTVTNLSEAVTWLSYTYLYVRMKKNPMVYGMDHSEPAKDPLLGSKRHEIIVDAARKL
ARCQMIIFDETTGYLTPTVLGRISSNFYIKHTSIEIFNGLMKPRMTEADVLSMMSMSSEF
DNIRSRESEHKELKGLLEKACACDIRGGTESTPGKVNILLQTYISNAYIDDFALVSDCGY
VAQNAGRIARALFEIALNRNWGPTSSIVLAINKSIEKRLWTFQHPLQQMGLPKDVMQKLE
DRSYDISIEEMRDMEPTELGDLIRHPRMGLTISRCVDQFPMLMLDAKIFPITRNVLNVEL
TITPDFVWNERLHGSSEPWWIWAEDSDSVEIYYSEYFILHRKQLGETMKIVFTVPIVEPL
PSEIYIRATSDRWLGAETVLPVSFENLVLPQLYPPPTELLDLRPLPVTALRNDVLEAICA
QKFTHFNPVQTQIFHTLYNTDNNALIGAPTGSGKTVAAELAMWRALGQHPGSKVLYIAPM
KSLVTEKAQDWNKRLMGPMNKRLVELTGDVNRDVKIIESADIIVTTPEKWDSVSRNQRSR
SCINKVSCVIIDEIHLLGGESGGPILEVIVSRMNYMGSKFDKKIRLVGLSTPLANAQDLA
DWLGVKKSGLFNFGHSVRPVPLEIYVDGFPGKLYCPRMATMNKPIYAAIKTHSPTQPVIV
FVSSRQQTCLTAQDLIAYCGMEDNPRQWLRTDDMEMEMILNQVDDEALKMSLAFGIAIHH
SSLTDNDRRIVEELFLNLKIQILIGTSTLAWGINLPAHLVIIKGTEFYNYKSGRYVDYPI
THVLQMMGRAGRPQFDNTGITRVFVQDSKKNFFKKFLYEPYPVESNLHKSMDDYIHAEIM
DKTIKTKQDALDYITWTYFYRRLQQNPTYYGLDDLSQRGLNTYMSNIVNEVTERLESSGY
LEIQNDFDLILKTPKE
Download sequence
Identical sequences jgi|Phybl1|62239|fgeneshPB_pg.5__77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]