SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|62269|fgeneshPB_pg.5__107 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|62269|fgeneshPB_pg.5__107
Domain Number 1 Region: 20-246,318-343
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 2.09e-40
Family Creatinase/aminopeptidase 0.00067
Further Details:      
 
Domain Number 2 Region: 249-316
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000612
Family Methionine aminopeptidase, insert domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|62269|fgeneshPB_pg.5__107
Sequence length 401
Sequence
MTDMEVTPIYSQTKFASDNDLNDPKVLEMYLISADIVNTVLPLVISKVSPGISVSDLCQF
GDDLILASTEGVYKNTERGIALPTCVTINNLVQYYSPLPENDYNLKPNDLVKIELGVHVN
GYIATAAHSTIVNPTPSQPIGGRAADVICATYFAHEAAIRMLRPGVKSSEISRVISEIAA
YYRCKPAEGTFSSLMKRFVLRAGKDIENQLNEEMTVKELENLDFEIEANQVYQLNIVLTT
SDGKVKTAEDKPFLYQRDVNASYQLKMRSARLAFSEINAKHTVFPFSTRALSGNQARLGL
VSLLAHHLVTPYTVMRTQLSSDLVAQYKSTVLVLADGPMQLTAAQPLPYVHSQYCIPQPT
NAANVLSTPAVKQARPTKHKATALDVNFGERRVDVQDVDMD
Download sequence
Identical sequences A0A162UZB4
XP_018297002.1.77709 jgi|Phybl1|62269|fgeneshPB_pg.5__107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]