SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|63136|fgeneshPB_pg.6__357 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|63136|fgeneshPB_pg.6__357
Domain Number 1 Region: 49-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.46e-30
Family Forkhead DNA-binding domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|63136|fgeneshPB_pg.6__357
Sequence length 210
Sequence
MPWSHSKPETLTHHDLHLSLTELDSEPSTNRQSDILITKNPQKTPRKRRRPPFSYSSLIA
QAILASEKERLTLQDIYKWITDNYPTLYNEGDTGWQNTIRHNLSLNKCFKKIPKSELDGW
PSRGKGGYWVVDPKYLVKFKSGIFIKGSPASMRQQKPLRQDRQEPFGRTSDKRQEQTIKP
CVNEPKRLFSVPPPPITTDLHKMQINTLLN
Download sequence
Identical sequences jgi|Phybl1|63136|fgeneshPB_pg.6__357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]