SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|63363|fgeneshPB_pg.7__63 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|63363|fgeneshPB_pg.7__63
Domain Number 1 Region: 32-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.43e-16
Family Cell cycle transcription factor e2f-dp 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|63363|fgeneshPB_pg.7__63
Sequence length 326
Sequence
MPNITRRNRKKSAHFQINSSGSMITSNIQSCRYDSSLGLLTKKFVSLLQSSTHGDLDLNS
AAAELNVQKRRIYDITNVLEGICLIEKNSKNHVRWTGSTPSLNSSSNNSQKNNYQHHLNH
DYNDNNDNNRRLDQIDEDTTELYRLEQRLLTLKSNNNSLLNEQNHLAQLTLEVNGRIERE
CSYHRDYCFLTSEDQARLEKQPMSQTDTLLAVHEPYDALIPCLDNIAPHTYNHHNHNHNH
NHHHNNSHSNTNHNNHNNSRSSFDRHRRQTSHIYPNHPYLPSTIENKHTVRCVVRVPDHS
DQSLFGRLSDGHRNQSLSRASSFYAS
Download sequence
Identical sequences jgi|Phybl1|63363|fgeneshPB_pg.7__63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]