SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|63432|fgeneshPB_pg.7__132 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|63432|fgeneshPB_pg.7__132
Domain Number 1 Region: 307-352
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000381
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|63432|fgeneshPB_pg.7__132
Sequence length 413
Sequence
MSANVFVQTTPENQILDLASYISKLRGEEGKEEAYVKEIKALLASDKKSEVYTKLAKDSS
VLLTENDKEVEGAFNLLVVITLSAPENNLAASVQALVDTLSKTESQKTSLKQKIEYIDNN
KGISSLLNLYNALPVTSALRYNAFVGLVDVTAQADELDSLYAQLEHIDRWVKQWGIDIET
ERNLYSNLSDKLRQAREEKLSLDFLLKKLSTYSQETVSTDCAKEAVTRAVDTENFFAFED
LLQYSAIQKIKGTPEYELLNVFLNGNLSTYKTFAASNPTLVKDSENNLRKMRLLSLASLG
SDNLARELTYAEVAKALDISEDEVEMWVIDVIRAGLVEAKLDQLNKNVIVHRSIYRVFGK
EQWQQLGARLNTWKDSLNEILAIISNAKLIAGGSQGGSAVVIEDKSVEVATKN
Download sequence
Identical sequences jgi|Phybl1|63432|fgeneshPB_pg.7__132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]