SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|66839|fgeneshPB_pg.16__231 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|66839|fgeneshPB_pg.16__231
Domain Number 1 Region: 44-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000019
Family Cell cycle transcription factor e2f-dp 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|66839|fgeneshPB_pg.16__231
Sequence length 282
Sequence
MNNSLSNPESDGHFQDPTHSQFITDEPASSSSSSSSSSASSTRRQDFSLGNITKHFIDLI
HSCTNGDLDLNKAADKLKVQKRRIYDITNVLEGIRLIEKNSKNHVRWIGDIPRDNSYLTR
TSPHSLAELEEKASRLRIANRALMEEKERLDAMNVAIDDKTRQLMAQNKAHCHITRNDLH
QFEKRKAPAAQQETKFLADPTTFDHDRPYKQDYRISHSATRSGRLSIQVPISHSHPYTLP
PHKSSKKCFNLAPDYSDQPIRLLGLPARKHRNSTLSLDHNLQ
Download sequence
Identical sequences A0A162TRI1
jgi|Phybl1|66839|fgeneshPB_pg.16__231 XP_018287233.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]