SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|66909|fgeneshPB_pg.16__301 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|66909|fgeneshPB_pg.16__301
Domain Number 1 Region: 322-399
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.1e-17
Family Cell cycle transcription factor e2f-dp 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|66909|fgeneshPB_pg.16__301
Sequence length 464
Sequence
MEPTYPSLHPLPNRLSPPTLPYTRHQSDNLNQHYNHHTNYKDYHHYNHTQHWRSHDLLQL
QSLLCNKPQQDTNNHLPPLILLSSISSSTTTSTNNNSPYGGQSPSLSTSFSSSSSSSSSS
SSSSPPLSSSSPSPSPAAESISTFPSPQQDQDFDLDHNKQHHWSPSPPSSSASDNVVVVD
DSVRGIVSVTSLLNPVPELPEPKRKKNRSGYLSDARNQMPATKIAPNRSSSNILLKRGRP
RQLTLNNTNMNMNMNSNNINSSIFGTSGTPPVAADHLHFTQNTKKQRRYKSKKNKTENNH
NDDDDDNHIALDVSEDHRRLNKGLRHFSKQVCDKVAKRGTTTYNEIADELATDIRNSPQD
NQPGCDQKNIRRRVYDALNVLTAINIIEKDKKEIKWLGIPGCTNTHSETAKREADLLREI
EEEERCHIELTASVEAAREKLAQASLSQMFALPNCPTAFPCPSS
Download sequence
Identical sequences A0A162TJN9
jgi|Phybl1|66909|fgeneshPB_pg.16__301 XP_018287162.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]