SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|67394|fgeneshPB_pg.18__185 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|67394|fgeneshPB_pg.18__185
Domain Number 1 Region: 162-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.26e-27
Family Forkhead DNA-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|67394|fgeneshPB_pg.18__185
Sequence length 399
Sequence
MATTVHLPGVRYLRNGEVDLQDQTLRVPMSDQRTTNVSHPIYPTRMMASWRSDDPLSGYQ
QPLIDTVSQIPHQNYRPVQVTTQAQTNYHLHSQQTMLYGQHSPYFPTNDLQEREVQQIQY
QHMQHVQIQQQLYQEQQKEKKVDQIQSTQDVSQRKTPSRKRRRPPHSYASLIAQAILTSR
NQKLSLRDIYDWIQAKYPHLYEANETGWQNTIRHNLSLNRCFRKVPRLAQDPLIRGKGSK
GGFWAVDMDQLSKTTFGRQILDSGMLNTVWSIHNVQQPMDDFDFQGLVSPLYHSAMETTR
SSAYSELLDQERASTAVFLARLSQPLSALSTPSFQQNEGSVTSDSTKTYSLRDVSPESPV
AIQTPLLSSMRLHEHKLDLESNDPLLLNPSLMRVNNILN
Download sequence
Identical sequences jgi|Phybl1|67394|fgeneshPB_pg.18__185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]