SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|68534|fgeneshPB_pg.23__145 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|68534|fgeneshPB_pg.23__145
Domain Number 1 Region: 207-298
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000018
Family DEP domain 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|68534|fgeneshPB_pg.23__145
Domain Number - Region: 341-359
Classification Level Classification E-value
Superfamily Bubble protein 0.0288
Family Bubble protein 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|68534|fgeneshPB_pg.23__145
Sequence length 388
Sequence
MSIQQDPPPPRIPPHGHDISYTASEKLAYLDSALSERMAGNPSTSWIQSAHPSPPPLSPH
RTNSPLTSLQPAGWEKFTREYGYPTRAASNTITPPIHYTRETNFGRRNHDSTTETSAILA
SSFESKSRYTENRHDIPSHPLGMTSSGIQEPRNITEQANIRQDKILFSPDEVQAQRSRSF
AYGTQSSVSRGHSKQIKQRLPLVYPALLSRVAQELRHRVILRDRIKNNVEYKNAFEGEEA
IDKIAMIIRTTDRWVALRLGRALGAQRFFHDVNYESRLVDSTTEIYQFDYRVCHYGASES
PMASPGTLTTSSSSASDFFNENASVATSLLELTDQYDGLPNGVFTELTHCYSSTCHGSQP
CYSYTCPKRTAMVCYLKLFFSNKKKEPN
Download sequence
Identical sequences jgi|Phybl1|68534|fgeneshPB_pg.23__145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]