SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|70377|fgeneshPB_pg.33__112 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|70377|fgeneshPB_pg.33__112
Domain Number 1 Region: 245-322
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000163
Family ELL N2 domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|70377|fgeneshPB_pg.33__112
Sequence length 788
Sequence
MYKNTGSSNIMYHTCDISHEGTLGEPSMIKEPTRKLPSAKTNENIQQQQQKRERLLDEED
KRDFPDTKKLKKPASKRPASVASAVSAHNQLQSTTVRETYNVNTESPTKNNNSEKLQPVV
RSVPASASHSTQTQQHSTAVSSGPSQSKIKNSFEKLSSSDISIKKTSSVDAPLRKVKNSE
VSGKRPSSLDQGSGRSSNTNTLSRRHDSIEPSPKRKHGTDLQTRRPSNVDTTLKRSTSTD
SRTSKDSLRKEVIHMLALNSASTRVLCRKLNVESQSIMPILNEVALPVEDQWHLYPIVHT
ELNIWEWPGYSEKNRRTVIQNTKNMYDKAMKLSPDAPERANLIFPTTPRSSRPNSGQQNT
SNNSSPLKDKNLLTIPKKRDHSKDENYGKQGLMGSVRRRSDQPGYSNGNERQKSSKKIEE
RVDPKKSASTKSSLGGIKATKESREVSTRSVSPASMPKQSKPSKLKSTALTSTKISEPKL
ETPTLTPTPTPTLTLTPTPAQSSIILSPSPTKLTVSENLHLKSSSKISAKIPIPTKTPGN
TPTPTKVITPTKFTEFTKTLPSQKIPMSSKMASPVKELVKVPSKKPAKLSVRAPTPPSKN
QVSQSPSIVPTLTPSAVPLPMATNVTPPQPSNTTTTPRYSSKSVVGWEKPPNEVKCGYID
TSNYDVSSNCFPQPYRAPIVNSQTQFSKLCLEHKKAQEEVKLLNETIDEQCPIIHEMLTK
SSVEVGPKDDVIVKLKAVFLDLEGHPEDWRYVVYIVKRLFWLRQKLELLYSIITTAHGLQ
GYIIPEDV
Download sequence
Identical sequences jgi|Phybl1|70377|fgeneshPB_pg.33__112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]