SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|70378|fgeneshPB_pg.33__113 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|70378|fgeneshPB_pg.33__113
Domain Number 1 Region: 225-300
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000907
Family PF0610-like 0.081
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|70378|fgeneshPB_pg.33__113
Domain Number - Region: 508-516,567-592
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00235
Family Formin homology 2 domain (FH2 domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|70378|fgeneshPB_pg.33__113
Sequence length 671
Sequence
MKNTAPKAISLRLPIEVLARLRSAQDGHKNFKLDVTSNGVNIILDDKTYTVTLTKSNDPA
HLYRQASHAISMIHSGDITYTGTVKEAPIAIEHRTPTKRDRTIDDADRTETPAPKKLKKP
SSRRTVPTSQSPSLPTDQSIARRSSTGSRRPTEKHQSQSHATTPLTNQLLRVSGSSSIGS
AHSKPNTPTQKSSSSNTSRRTSSTDRSTKRRKSVESSRPSAATNAIREKLIHILAAESLS
PQTLSRKLGVSTSTFMPILKKVALSTNGIWYLMPEIYPEVKIWTWSEYDDKTRRAVAREA
EEMFKRMKYAPDAPERANLIPPVQPKLPSQPTIHKQGSHLSPVIDRDGLNKKRDLSLEDR
PRKRSPSVTSRRVSENYDTLSTSVHQRKRELLDVKSTKGKSTPPLQPQPSNIISKSKETD
LRSVHSISPIDRIMDQKDKKIAPPIHPNSRPKHAESKKSVPVSSSNHTPQRLPIKSPLPP
LPPPPPQLAPKDHSSPPPPPTVPAPIQPPPPPPPPPLSSIPSKTSTHDSKREIRRIKKAE
DILARSSSESPDGFPKPYRLPNVTSQAHFNKLCIEHKHAQEEAWALKHTIDTQCPVVHEL
FKKNLLNLGPSDNISDKVREAFENLGGDSRDWIYVVYMTKRFFWLSQKIKLLYPFIENTC
SKKEFTIPDGI
Download sequence
Identical sequences jgi|Phybl1|70378|fgeneshPB_pg.33__113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]