SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|70381|fgeneshPB_pg.33__116 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|70381|fgeneshPB_pg.33__116
Domain Number 1 Region: 479-605
Classification Level Classification E-value
Superfamily CheY-like 8.25e-34
Family CheY-related 0.0022
Further Details:      
 
Domain Number 2 Region: 43-149
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-31
Family Heat-shock transcription factor 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|70381|fgeneshPB_pg.33__116
Sequence length 765
Sequence
MERPTIKGYPSPPSTITRKDIMNPTPRKTPVKPTGKTADGAGSVPEFIQKLFRMLENKAF
RNTFCWGPNGKTFIVKDTNEFSKTILPKHFKHCNFASFVRQLNKYDFHKVRNAEDAPKSY
GDQASKAWEFVHPKFIRDRKDLLEEIRRKTPGKQKKDETNNESDTNSTRTLVPEQQQIQQ
QQIQQQQQQQQQQQQQQQQQQQQQQQQPHQTKNQQQQQPHQQNQTQTQQQSQSQQQTQPQ
QQSPNSAVADSIKDVRHIVAGLQSQIEQLQQSRAELEKTFEKRIRLDGTVLNELLMFNKN
MVAKDNLIKDFLQQSAQREKETNPLRVNSRDSTHSLLTCYSEAARVNAEQMQRITQQLQA
SQHYTWIDEPDKKPVKRECYPDDTPQSLNNTTQPDMTTSTNAPSSTSTSPPPICSATAAV
SMNAGSLVGSPLKTAEGVAFVTLGRVSPHVAIRDNKPGIELTMPTIDNTKKATFSWTVPP
RVLLVDDDSVYRDLSGKLLQVIGCTIDLAKDGVEAIGKMGAEKYDLILMDIMMPNLDGIS
ATRNIRQYDALTPIISMTSNFTDNDIMQYIGSGMTDILPKPFSKRTLYNMLEKYCAHLRA
IQRGQGSADQISAVQRGLGNLGLPLQCLTPNAMQLEPANNTTSTTSNSSSSSSSSSSNNN
NGQYSETSVASSSSSSSSSFVYPYPTTMVGFSHSPYSAPAGSPTTFWISQDQPEVLPPSN
DGPTIITSADGKLRWAAPPPPTALPIYDTDPNTKRRRLDHGKDHV
Download sequence
Identical sequences jgi|Phybl1|70381|fgeneshPB_pg.33__116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]