SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|71075|fgeneshPB_pg.39__9 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|71075|fgeneshPB_pg.39__9
Domain Number 1 Region: 612-825
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-45
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 481-548
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000141
Family DEP domain 0.024
Further Details:      
 
Domain Number 3 Region: 836-910,993-1025
Classification Level Classification E-value
Superfamily PH domain-like 0.00000984
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|71075|fgeneshPB_pg.39__9
Sequence length 1041
Sequence
MDNTTSSNTTHTTHFDGGPMPDEVRNSYTQQQLPVRNQSLASFNHLPNHTPIQNKPKDTN
STTSTNTITPSSRRLSITAWMTTSKSCRYFGTRDSPPSTDKTTHPPPSCPSSSLFSISSS
HSPAPTPTTASLAALTPQKRHNHHNHQNHHSHHKHSDLPTPASCLCLMDIKEPFQSGSSP
SSLVPTRFSILGITNSHSPEKQDKDDETTGSSSTDAMSPIAWKQLDKRIRLSKSESNLVL
SFTGETDHQTSCEPAEKQTTELSQSWNERSNSFSKLRNVFLRLNSRKQPNRQPTPQTRAQ
ANADANAHTHTHTHTHTHTHTPNKKAHTPHTPHTPHIPHTAKASSPTQKTGTGIETAAGT
TASNQVYSSPASTSISGSAESPAPTSRQLTIPIPQASASVSTISPSISVSTLTSMLSFVS
TEKPAQSSNSTKQPCLSTVYYPPKRPQIQPKQSYTDDRVYPALLSHIAREIYRRLQTGTL
VKNGIVYHDVFSGKEATDCMAVILNHKNRNLALLVGRALDSQGFINEVNYEHRLRDSPGA
LYRFRSHHGLPVEMIDEEQRIKTKDDVLMDTKRVNGIFTVLTECYSPTCTRGSPCYSYSC
PRTTRKSTNRLWRHSISKHILESISAEERKRQECIYELIYTEKDFCWITPLLTSDIIPAE
RRERFVQQVFWNLPDIEQVNSLLCESLLNRQRKNPVIHRIGDLMLHHVSFFAPFVGYGAH
QVIGKFSFELEKKRNPRFVQFVEKTERLPASRRLELNGYLTKPTARLGRYNLFFREIMKC
TDKTNEDVVQLPKVMEIIRGYLSQMNKEIGETENRFNLQQMEARLSYKSATDIADLQLLE
PERRLIMKGRMKRKNNSTSDASDIQVFLLDHYLVFAKIKYHDHLEFYKVFRKPIPLTSLS
YHVPQETRARTSTYRLSYSKSSPTTALSTSTSTATTTALSTTNTNTTPSTTITAATTAAN
ASTPNTAYPSSKFTSASSTTARPPVANNDSKAKCHPIAFIDLRNGTPITLYTSTDSTRSI
WLEKLDEHKYGKSIVLTDQDT
Download sequence
Identical sequences jgi|Phybl1|71075|fgeneshPB_pg.39__9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]