SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|71867|fgeneshPB_pg.46__69 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|71867|fgeneshPB_pg.46__69
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-28
Family Heat-shock transcription factor 0.00035
Further Details:      
 
Weak hits

Sequence:  jgi|Phybl1|71867|fgeneshPB_pg.46__69
Domain Number - Region: 230-282
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 0.0732
Family XRCC4, C-terminal oligomerization domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|71867|fgeneshPB_pg.46__69
Sequence length 361
Sequence
MNRSTLLTDCEGSQSPCNDQHGGSVRNIFRIAPQVSAAFITKLYRILGIEESQNFISWSP
SGTQFCVHDMHQFSKDILPQYFKHNNWPSFVRQLNMYGFHKVGEVSGSHSRALIRHDSNV
VYKFRHPDFQRNRQDLLHRIRRKKARLSHQTAFHYTNGFDMVKHQERQGDNNSVDNNSNN
SNNSNDSHSIRYQQHQDINNDSYNNSPESSTECLGRKHENSTGFTSVEEGISVSMDQIYH
IDETLERLKKKSDTAQQEIDDLRQSIMLQQNLLERFATIMNTNADFSAKESMIYAMEQLK
THAHDISIRENDDHERQLGYSNEQGDFNSPSLATNGWILANKQRRMNAIQSICNLPINTL
P
Download sequence
Identical sequences jgi|Phybl1|71867|fgeneshPB_pg.46__69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]