SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|73133|fgeneshPB_pg.65__16 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|73133|fgeneshPB_pg.65__16
Domain Number 1 Region: 7-182,356-474
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.96e-43
Family FCH domain 0.0087
Further Details:      
 
Domain Number 2 Region: 481-705
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-20
Family BCR-homology GTPase activation domain (BH-domain) 0.0086
Further Details:      
 
Domain Number 3 Region: 223-310
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000267
Family DEP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|73133|fgeneshPB_pg.65__16
Sequence length 890
Sequence
MASALHFETSFWSQKQPHSTLPDFQSGLQILHQKLQQSKVENEEVITFFKDRISIEESYG
NKLIDQSKIPSKNSGFGRDEGAGLRSCFENFKVASSQFGTHHKETAATMTDSALKPLQTF
NEDYKNMVATSRQQLDSNLKQFDGLYKDAERAKSLYNRRCREADQAEEQAVQQASLEAPP
LQPPTSPTEQSQPPAEPAPPVPPKDIITVRLGSQVLTPAEFDTLIQQMRKEIPVKDHRVP
ILGTYKSTSTGEDIARWLQHNLAQCKDSPAMADIVGQQLIQPHGVLRLIAQRGNKFLPSA
TSYYQWRIRDPEEEAGSVGSNPTTSALGGIFEKLGGGIAVGNGGVNGGAGAGGSPVVPGE
EPYKKARMDAERADEAYRSAVKRVDRMRTVIEEALFTHFAEMEKVELRRLDTLKQVFSAF
ASCLSASLPGDKAIVDQMRLFLESLKPEQDIQYIVQQYCTASFSPKAMLYENYYHGIAHD
QIFGVPLEELGKQTENGVPQFVTYALEAITQGANEMSLEEKRKLWSTPLGLESVHTARAD
INIASSRITVDLLKQYEPGLLVAVLRLFLLELPEPLLTFEFYDPAQALYNSNSKIMCGYD
ILTASFFFFFLIGEQDESMRIFPLSHLISSLPGSHFNTLDALLTHLDTFIRQFSKAPLEE
EEIFKISQILGPIILRSRVETLTTLTSRVPRHLAHDLIKYHKDIFSEVTYRAHAESEKRR
QTRLVALRTTEQTEAETKKRGLMSFIRPSEETKWGVNSVMGVFQRNGNGSGGGSGSGGSG
SGGGTSTSPPVPSPSDSRSFTPPTSMHFGSVITQESPPSSPTLPPKADPPPPSSSSPPSQ
VMFDVADHISDKPASIKETDKKEVVEAPPPHQPKEESQPEGELDPFFADD
Download sequence
Identical sequences A0A162T432
XP_018284162.1.77709 jgi|Phybl1|73133|fgeneshPB_pg.65__16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]