SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phybl1|73274|fgeneshPB_pg.67__48 from Phycomyces blakesleeanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phybl1|73274|fgeneshPB_pg.67__48
Domain Number 1 Region: 79-135
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000215
Family Canonical RBD 0.01
Further Details:      
 
Domain Number 2 Region: 6-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000635
Family La domain 0.0054
Further Details:      
 
Domain Number 3 Region: 243-312
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000215
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phybl1|73274|fgeneshPB_pg.67__48
Sequence length 358
Sequence
MSDDRKLANILETYFSDANLLWDKVLQSKINNDPDGFVSFNSLQTLSRFKKLNATAQDIK
HAAVNHSLSKLKEGLQKPYHTEQAIKELFGSLIGHVSFVRIPKNTQGCSGFYGFCFVEFD
DRDNVNKAVRLLNRFNTSALCSEDQSNIVKTNEKKGENNVEDGDKNSNENVIEQANKLSL
RVMSKSDWNKLKEEYLEVQAARAAYTRDQWSKYYASLPNTAEEIPGPEPQQQKKKKGEEL
PETMEYTKGIIVYVGNIHPKSSKTVISKLLEKSGLLVPYIGRKKGLDYCHARLSSPEDAQ
QLVKYFENHPVIQENHTDDTGKAASTADMFKVNLRIISGKEEEFYWQDDIAGSKKLFT
Download sequence
Identical sequences A0A162T3C0
XP_018283992.1.77709 jgi|Phybl1|73274|fgeneshPB_pg.67__48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]